HSPA4 monoclonal antibody (M01), clone 3A11
  • HSPA4 monoclonal antibody (M01), clone 3A11

HSPA4 monoclonal antibody (M01), clone 3A11

Ref: AB-H00003308-M01
HSPA4 monoclonal antibody (M01), clone 3A11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant HSPA4.
Información adicional
Size 100 ug
Gene Name HSPA4
Gene Alias APG-2|HS24/P52|MGC131852|RY|hsp70|hsp70RY
Gene Description heat shock 70kDa protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSPA4 (AAH02526, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3308
Clone Number 3A11
Iso type IgG2a Kappa

Enviar uma mensagem


HSPA4 monoclonal antibody (M01), clone 3A11

HSPA4 monoclonal antibody (M01), clone 3A11