HSPA4 purified MaxPab rabbit polyclonal antibody (D01P)
  • HSPA4 purified MaxPab rabbit polyclonal antibody (D01P)

HSPA4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003308-D01P
HSPA4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HSPA4 protein.
Información adicional
Size 100 ug
Gene Name HSPA4
Gene Alias APG-2|HS24/P52|MGC131852|RY|hsp70|hsp70RY
Gene Description heat shock 70kDa protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HSPA4 (AAI10862.1, 1 a.a. ~ 840 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3308

Enviar uma mensagem


HSPA4 purified MaxPab rabbit polyclonal antibody (D01P)

HSPA4 purified MaxPab rabbit polyclonal antibody (D01P)