HSPA1A polyclonal antibody (A01)
  • HSPA1A polyclonal antibody (A01)

HSPA1A polyclonal antibody (A01)

Ref: AB-H00003303-A01
HSPA1A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant HSPA1A.
Información adicional
Size 50 uL
Gene Name HSPA1A
Gene Alias FLJ54303|FLJ54370|FLJ54392|FLJ54408|FLJ75127|HSP70-1|HSP70-1A|HSP70I|HSP72|HSPA1|HSPA1B
Gene Description heat shock 70kDa protein 1A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSPA1A (AAH02453, 1 a.a. ~ 641 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3303

Enviar uma mensagem


HSPA1A polyclonal antibody (A01)

HSPA1A polyclonal antibody (A01)