DNAJB2 polyclonal antibody (A01)
  • DNAJB2 polyclonal antibody (A01)

DNAJB2 polyclonal antibody (A01)

Ref: AB-H00003300-A01
DNAJB2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DNAJB2.
Información adicional
Size 50 uL
Gene Name DNAJB2
Gene Alias HSJ1|HSPF3
Gene Description DnaJ (Hsp40) homolog, subfamily B, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQEGARGEATKRSPSPEEKASRCLIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DNAJB2 (NP_006727, 216 a.a. ~ 324 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3300

Enviar uma mensagem


DNAJB2 polyclonal antibody (A01)

DNAJB2 polyclonal antibody (A01)