HSF4 monoclonal antibody (M06), clone 4F10
  • HSF4 monoclonal antibody (M06), clone 4F10

HSF4 monoclonal antibody (M06), clone 4F10

Ref: AB-H00003299-M06
HSF4 monoclonal antibody (M06), clone 4F10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HSF4.
Información adicional
Size 100 ug
Gene Name HSF4
Gene Alias CTM
Gene Description heat shock transcription factor 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSF4 (NP_001529, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3299
Clone Number 4F10
Iso type IgG2b Kappa

Enviar uma mensagem


HSF4 monoclonal antibody (M06), clone 4F10

HSF4 monoclonal antibody (M06), clone 4F10