HSF2 polyclonal antibody (A01)
  • HSF2 polyclonal antibody (A01)

HSF2 polyclonal antibody (A01)

Ref: AB-H00003298-A01
HSF2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant HSF2.
Información adicional
Size 50 uL
Gene Name HSF2
Gene Alias MGC117376|MGC156196|MGC75048
Gene Description heat shock transcription factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVIF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSF2 (AAH05329, 1 a.a. ~ 230 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3298

Enviar uma mensagem


HSF2 polyclonal antibody (A01)

HSF2 polyclonal antibody (A01)