HSD11B2 purified MaxPab rabbit polyclonal antibody (D01P)
  • HSD11B2 purified MaxPab rabbit polyclonal antibody (D01P)

HSD11B2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003291-D01P
HSD11B2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HSD11B2 protein.
Información adicional
Size 100 ug
Gene Name HSD11B2
Gene Alias AME|AME1|HSD11K|HSD2|SDR9C3
Gene Description hydroxysteroid (11-beta) dehydrogenase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HSD11B2 (AAH64536.1, 1 a.a. ~ 405 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3291

Enviar uma mensagem


HSD11B2 purified MaxPab rabbit polyclonal antibody (D01P)

HSD11B2 purified MaxPab rabbit polyclonal antibody (D01P)