HSD3B1 MaxPab rabbit polyclonal antibody (D01)
  • HSD3B1 MaxPab rabbit polyclonal antibody (D01)

HSD3B1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003283-D01
HSD3B1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HSD3B1 protein.
Información adicional
Size 100 uL
Gene Name HSD3B1
Gene Alias HSD3B|HSDB3|SDR11E1
Gene Description hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALQDPKKAPSIRGQFYY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HSD3B1 (NP_000853.1, 1 a.a. ~ 373 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3283

Enviar uma mensagem


HSD3B1 MaxPab rabbit polyclonal antibody (D01)

HSD3B1 MaxPab rabbit polyclonal antibody (D01)