HSD3B1 polyclonal antibody (A01)
  • HSD3B1 polyclonal antibody (A01)

HSD3B1 polyclonal antibody (A01)

Ref: AB-H00003283-A01
HSD3B1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant HSD3B1.
Información adicional
Size 50 uL
Gene Name HSD3B1
Gene Alias HSD3B|HSDB3|SDR11E1
Gene Description hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALQDPKKAPSIRGQFYY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSD3B1 (AAH31999.1, 1 a.a. ~ 373 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3283

Enviar uma mensagem


HSD3B1 polyclonal antibody (A01)

HSD3B1 polyclonal antibody (A01)