HSBP1 monoclonal antibody (M02), clone 2C3
  • HSBP1 monoclonal antibody (M02), clone 2C3

HSBP1 monoclonal antibody (M02), clone 2C3

Ref: AB-H00003281-M02
HSBP1 monoclonal antibody (M02), clone 2C3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant HSBP1.
Información adicional
Size 100 ug
Gene Name HSBP1
Gene Alias DKFZp686D1664|DKFZp686O24200|NPC-A-13
Gene Description heat shock factor binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSBP1 (AAH07515, 1 a.a. ~ 76 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3281
Clone Number 2C3
Iso type IgG2a Kappa

Enviar uma mensagem


HSBP1 monoclonal antibody (M02), clone 2C3

HSBP1 monoclonal antibody (M02), clone 2C3