HES1 monoclonal antibody (M17), clone 1A6
  • HES1 monoclonal antibody (M17), clone 1A6

HES1 monoclonal antibody (M17), clone 1A6

Ref: AB-H00003280-M17
HES1 monoclonal antibody (M17), clone 1A6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant HES1.
Información adicional
Size 100 ug
Gene Name HES1
Gene Alias FLJ20408|HES-1|HHL|HRY|bHLHb39
Gene Description hairy and enhancer of split 1, (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq APCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HES1 (NP_005515.1, 201 a.a. ~ 280 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3280
Clone Number 1A6
Iso type IgG2a Kappa

Enviar uma mensagem


HES1 monoclonal antibody (M17), clone 1A6

HES1 monoclonal antibody (M17), clone 1A6