HES1 monoclonal antibody (M01), clone 4D9
  • HES1 monoclonal antibody (M01), clone 4D9

HES1 monoclonal antibody (M01), clone 4D9

Ref: AB-H00003280-M01
HES1 monoclonal antibody (M01), clone 4D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HES1.
Información adicional
Size 100 ug
Gene Name HES1
Gene Alias FLJ20408|HES-1|HHL|HRY|bHLHb39
Gene Description hairy and enhancer of split 1, (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HES1 (NP_005515, 36 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3280
Clone Number 4D9
Iso type IgG2b Kappa

Enviar uma mensagem


HES1 monoclonal antibody (M01), clone 4D9

HES1 monoclonal antibody (M01), clone 4D9