HES1 polyclonal antibody (A01)
  • HES1 polyclonal antibody (A01)

HES1 polyclonal antibody (A01)

Ref: AB-H00003280-A01
HES1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HES1.
Información adicional
Size 50 uL
Gene Name HES1
Gene Alias FLJ20408|HES-1|HHL|HRY|bHLHb39
Gene Description hairy and enhancer of split 1, (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HES1 (NP_005515, 36 a.a. ~ 142 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3280

Enviar uma mensagem


HES1 polyclonal antibody (A01)

HES1 polyclonal antibody (A01)