HPGD purified MaxPab rabbit polyclonal antibody (D01P)
  • HPGD purified MaxPab rabbit polyclonal antibody (D01P)

HPGD purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003248-D01P
HPGD purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HPGD protein.
Información adicional
Size 100 ug
Gene Name HPGD
Gene Alias 15-PGDH|PGDH|PGDH1|SDR36C1
Gene Description hydroxyprostaglandin dehydrogenase 15-(NAD)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HPGD (AAH18986.1, 1 a.a. ~ 266 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3248

Enviar uma mensagem


HPGD purified MaxPab rabbit polyclonal antibody (D01P)

HPGD purified MaxPab rabbit polyclonal antibody (D01P)