HOXB7 purified MaxPab rabbit polyclonal antibody (D01P)
  • HOXB7 purified MaxPab rabbit polyclonal antibody (D01P)

HOXB7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003217-D01P
HOXB7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HOXB7 protein.
Información adicional
Size 100 ug
Gene Name HOXB7
Gene Alias HHO.C1|HOX2|HOX2C|Hox-2.3
Gene Description homeobox B7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSSLYYANALFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HOXB7 (AAH15345.1, 1 a.a. ~ 217 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3217

Enviar uma mensagem


HOXB7 purified MaxPab rabbit polyclonal antibody (D01P)

HOXB7 purified MaxPab rabbit polyclonal antibody (D01P)