HPCA purified MaxPab mouse polyclonal antibody (B01P)
  • HPCA purified MaxPab mouse polyclonal antibody (B01P)

HPCA purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003208-B01P
HPCA purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HPCA protein.
Información adicional
Size 50 ug
Gene Name HPCA
Gene Alias BDR2
Gene Description hippocalcin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSPGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSRSQF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HPCA (NP_002134, 1 a.a. ~ 193 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3208

Enviar uma mensagem


HPCA purified MaxPab mouse polyclonal antibody (B01P)

HPCA purified MaxPab mouse polyclonal antibody (B01P)