HOXA1 MaxPab rabbit polyclonal antibody (D01)
  • HOXA1 MaxPab rabbit polyclonal antibody (D01)

HOXA1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003198-D01
HOXA1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HOXA1 protein.
Información adicional
Size 100 uL
Gene Name HOXA1
Gene Alias BSAS|HOX1|HOX1F|MGC45232
Gene Description homeobox A1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HOXA1 (NP_005513.1, 1 a.a. ~ 335 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3198

Enviar uma mensagem


HOXA1 MaxPab rabbit polyclonal antibody (D01)

HOXA1 MaxPab rabbit polyclonal antibody (D01)