HNRNPD purified MaxPab rabbit polyclonal antibody (D01P)
  • HNRNPD purified MaxPab rabbit polyclonal antibody (D01P)

HNRNPD purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003184-D01P
HNRNPD purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HNRNPD protein.
Información adicional
Size 100 ug
Gene Name HNRNPD
Gene Alias AUF1|AUF1A|HNRPD|P37|hnRNPD0
Gene Description heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HNRNPD (NP_112738.1, 1 a.a. ~ 355 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3184

Enviar uma mensagem


HNRNPD purified MaxPab rabbit polyclonal antibody (D01P)

HNRNPD purified MaxPab rabbit polyclonal antibody (D01P)