SLC29A2 purified MaxPab mouse polyclonal antibody (B02P)
  • SLC29A2 purified MaxPab mouse polyclonal antibody (B02P)

SLC29A2 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00003177-B02P
SLC29A2 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SLC29A2 protein.
Información adicional
Size 50 ug
Gene Name SLC29A2
Gene Alias DER12|ENT2|HNP36
Gene Description solute carrier family 29 (nucleoside transporters), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MARGDAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGAGNSTARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRILGSLLAILLLFALTAALVKVDMSPGPFFSITMASVCFINSFSAVLQGSLFGQLGTMPSTYSTLFLSGQGLAGIFAALAMLLSMASGVDAETSALGYFITPCVGILMSIVCYLSLPHLKFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC29A2 (NP_001523.2, 1 a.a. ~ 456 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3177

Enviar uma mensagem


SLC29A2 purified MaxPab mouse polyclonal antibody (B02P)

SLC29A2 purified MaxPab mouse polyclonal antibody (B02P)