HNMT monoclonal antibody (M04A), clone 2G12
  • HNMT monoclonal antibody (M04A), clone 2G12

HNMT monoclonal antibody (M04A), clone 2G12

Ref: AB-H00003176-M04A
HNMT monoclonal antibody (M04A), clone 2G12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HNMT.
Información adicional
Size 200 uL
Gene Name HNMT
Gene Alias HMT|HNMT-S1|HNMT-S2
Gene Description histamine N-methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HNMT (NP_008826, 184 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 3176
Clone Number 2G12
Iso type IgG Mix Kappa

Enviar uma mensagem


HNMT monoclonal antibody (M04A), clone 2G12

HNMT monoclonal antibody (M04A), clone 2G12