HNMT monoclonal antibody (M03), clone 3G12
  • HNMT monoclonal antibody (M03), clone 3G12

HNMT monoclonal antibody (M03), clone 3G12

Ref: AB-H00003176-M03
HNMT monoclonal antibody (M03), clone 3G12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HNMT.
Información adicional
Size 100 ug
Gene Name HNMT
Gene Alias HMT|HNMT-S1|HNMT-S2
Gene Description histamine N-methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HNMT (NP_008826, 184 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3176
Clone Number 3G12
Iso type IgG2b Kappa

Enviar uma mensagem


HNMT monoclonal antibody (M03), clone 3G12

HNMT monoclonal antibody (M03), clone 3G12