HNMT purified MaxPab rabbit polyclonal antibody (D01P)
  • HNMT purified MaxPab rabbit polyclonal antibody (D01P)

HNMT purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003176-D01P
HNMT purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HNMT protein.
Información adicional
Size 100 ug
Gene Name HNMT
Gene Alias HMT|HNMT-S1|HNMT-S2
Gene Description histamine N-methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGDENGDLLWDFLTETCNFNATAP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HNMT (AAH20677.1, 1 a.a. ~ 292 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3176

Enviar uma mensagem


HNMT purified MaxPab rabbit polyclonal antibody (D01P)

HNMT purified MaxPab rabbit polyclonal antibody (D01P)