FOXA3 purified MaxPab mouse polyclonal antibody (B01P)
  • FOXA3 purified MaxPab mouse polyclonal antibody (B01P)

FOXA3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003171-B01P
FOXA3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FOXA3 protein.
Información adicional
Size 50 ug
Gene Name FOXA3
Gene Alias FKHH3|HNF3G|MGC10179|TCF3G
Gene Description forkhead box A3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FOXA3 (NP_004488.2, 1 a.a. ~ 350 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3171

Enviar uma mensagem


FOXA3 purified MaxPab mouse polyclonal antibody (B01P)

FOXA3 purified MaxPab mouse polyclonal antibody (B01P)