FOXA2 purified MaxPab rabbit polyclonal antibody (D01P)
  • FOXA2 purified MaxPab rabbit polyclonal antibody (D01P)

FOXA2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003170-D01P
FOXA2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FOXA2 protein.
Información adicional
Size 100 ug
Gene Name FOXA2
Gene Alias HNF3B|MGC19807|TCF3B
Gene Description forkhead box A2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FOXA2 (NP_068556.1, 1 a.a. ~ 457 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3170

Enviar uma mensagem


FOXA2 purified MaxPab rabbit polyclonal antibody (D01P)

FOXA2 purified MaxPab rabbit polyclonal antibody (D01P)