NR4A1 purified MaxPab rabbit polyclonal antibody (D01P)
  • NR4A1 purified MaxPab rabbit polyclonal antibody (D01P)

NR4A1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003164-D01P
NR4A1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NR4A1 protein.
Información adicional
Size 100 ug
Gene Name NR4A1
Gene Alias GFRP1|HMR|MGC9485|N10|NAK-1|NGFIB|NP10|NUR77|TR3
Gene Description nuclear receptor subfamily 4, group A, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NR4A1 (NP_002126.2, 1 a.a. ~ 598 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3164

Enviar uma mensagem


NR4A1 purified MaxPab rabbit polyclonal antibody (D01P)

NR4A1 purified MaxPab rabbit polyclonal antibody (D01P)