HMOX1 monoclonal antibody (M01), clone 5C6
  • HMOX1 monoclonal antibody (M01), clone 5C6

HMOX1 monoclonal antibody (M01), clone 5C6

Ref: AB-H00003162-M01
HMOX1 monoclonal antibody (M01), clone 5C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HMOX1.
Información adicional
Size 100 ug
Gene Name HMOX1
Gene Alias HO-1|HSP32|bK286B10
Gene Description heme oxygenase (decycling) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HMOX1 (ENSP00000216117, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3162
Clone Number 5C6
Iso type IgG2a Kappa

Enviar uma mensagem


HMOX1 monoclonal antibody (M01), clone 5C6

HMOX1 monoclonal antibody (M01), clone 5C6