HMOX1 polyclonal antibody (A02)
  • HMOX1 polyclonal antibody (A02)

HMOX1 polyclonal antibody (A02)

Ref: AB-H00003162-A02
HMOX1 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HMOX1.
Información adicional
Size 50 uL
Gene Name HMOX1
Gene Alias HO-1|HSP32|bK286B10
Gene Description heme oxygenase (decycling) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HMOX1 (ENSP00000216117, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3162

Enviar uma mensagem


HMOX1 polyclonal antibody (A02)

HMOX1 polyclonal antibody (A02)