HMGCR MaxPab rabbit polyclonal antibody (D01)
  • HMGCR MaxPab rabbit polyclonal antibody (D01)

HMGCR MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003156-D01
HMGCR MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HMGCR protein.
Información adicional
Size 100 uL
Gene Name HMGCR
Gene Alias -
Gene Description 3-hydroxy-3-methylglutaryl-Coenzyme A reductase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFARVLEEEENKPNPVTQR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HMGCR (AAH33692.1, 1 a.a. ~ 835 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3156

Enviar uma mensagem


HMGCR MaxPab rabbit polyclonal antibody (D01)

HMGCR MaxPab rabbit polyclonal antibody (D01)