HMGCL purified MaxPab rabbit polyclonal antibody (D01P)
  • HMGCL purified MaxPab rabbit polyclonal antibody (D01P)

HMGCL purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003155-D01P
HMGCL purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HMGCL protein.
Información adicional
Size 100 ug
Gene Name HMGCL
Gene Alias HL
Gene Description 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAMRKALPRRLVGLASLRAVSTSSMGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAASELFTKKNINCSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKISPAKVAEVTKKFYSMGCYEISLGDTIGVGTPGIMKDMLSAVMQEVPLAALAVHCHDTYGQALANTLMALQMGVSV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HMGCL (NP_000182.2, 1 a.a. ~ 325 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3155

Enviar uma mensagem


HMGCL purified MaxPab rabbit polyclonal antibody (D01P)

HMGCL purified MaxPab rabbit polyclonal antibody (D01P)