HMGN2 polyclonal antibody (A01)
  • HMGN2 polyclonal antibody (A01)

HMGN2 polyclonal antibody (A01)

Ref: AB-H00003151-A01
HMGN2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant HMGN2.
Información adicional
Size 50 uL
Gene Name HMGN2
Gene Alias HMG17|MGC5629|MGC88718
Gene Description high-mobility group nucleosomal binding domain 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPKRKAEEDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HMGN2 (AAH14644, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3151

Enviar uma mensagem


HMGN2 polyclonal antibody (A01)

HMGN2 polyclonal antibody (A01)