HMGB2 monoclonal antibody (M02), clone 4G7
  • HMGB2 monoclonal antibody (M02), clone 4G7

HMGB2 monoclonal antibody (M02), clone 4G7

Ref: AB-H00003148-M02
HMGB2 monoclonal antibody (M02), clone 4G7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant HMGB2.
Información adicional
Size 100 ug
Gene Name HMGB2
Gene Alias HMG2
Gene Description high-mobility group box 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HMGB2 (AAH00903.2, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3148
Clone Number 4G7
Iso type IgG2a Kappa

Enviar uma mensagem


HMGB2 monoclonal antibody (M02), clone 4G7

HMGB2 monoclonal antibody (M02), clone 4G7