HMGB2 purified MaxPab rabbit polyclonal antibody (D01P)
  • HMGB2 purified MaxPab rabbit polyclonal antibody (D01P)

HMGB2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003148-D01P
HMGB2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HMGB2 protein.
Información adicional
Size 100 ug
Gene Name HMGB2
Gene Alias HMG2
Gene Description high-mobility group box 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HMGB2 (NP_002120.1, 1 a.a. ~ 209 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3148

Enviar uma mensagem


HMGB2 purified MaxPab rabbit polyclonal antibody (D01P)

HMGB2 purified MaxPab rabbit polyclonal antibody (D01P)