HMGB2 polyclonal antibody (A01)
  • HMGB2 polyclonal antibody (A01)

HMGB2 polyclonal antibody (A01)

Ref: AB-H00003148-A01
HMGB2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HMGB2.
Información adicional
Size 50 uL
Gene Name HMGB2
Gene Alias HMG2
Gene Description high-mobility group box 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HMGB2 (NP_002120, 91 a.a. ~ 187 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3148

Enviar uma mensagem


HMGB2 polyclonal antibody (A01)

HMGB2 polyclonal antibody (A01)