HMGB1 monoclonal antibody (M04), clone 1B2 View larger

Mouse monoclonal antibody raised against a full length recombinant HMGB1.

AB-H00003146-M04

New product

HMGB1 monoclonal antibody (M04), clone 1B2

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name HMGB1
Gene Alias DKFZp686A04236|HMG1|HMG3|SBP-1
Gene Description high-mobility group box 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HMGB1 (AAH03378.1, 1 a.a. ~ 215 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3146
Clone Number 1B2
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a full length recombinant HMGB1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full length recombinant HMGB1.

Mouse monoclonal antibody raised against a full length recombinant HMGB1.