HMGB1 MaxPab rabbit polyclonal antibody (D01)
  • HMGB1 MaxPab rabbit polyclonal antibody (D01)

HMGB1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003146-D01
HMGB1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HMGB1 protein.
Información adicional
Size 100 uL
Gene Name HMGB1
Gene Alias DKFZp686A04236|HMG1|HMG3|SBP-1
Gene Description high-mobility group box 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HMGB1 (NP_002119.1, 1 a.a. ~ 215 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3146

Enviar uma mensagem


HMGB1 MaxPab rabbit polyclonal antibody (D01)

HMGB1 MaxPab rabbit polyclonal antibody (D01)