HMGB1 polyclonal antibody (A01)
  • HMGB1 polyclonal antibody (A01)

HMGB1 polyclonal antibody (A01)

Ref: AB-H00003146-A01
HMGB1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HMGB1.
Información adicional
Size 50 uL
Gene Name HMGB1
Gene Alias DKFZp686A04236|HMG1|HMG3|SBP-1
Gene Description high-mobility group box 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HMGB1 (NP_002119, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3146

Enviar uma mensagem


HMGB1 polyclonal antibody (A01)

HMGB1 polyclonal antibody (A01)