HLX1 monoclonal antibody (M05), clone 1B9
  • HLX1 monoclonal antibody (M05), clone 1B9

HLX1 monoclonal antibody (M05), clone 1B9

Ref: AB-H00003142-M05
HLX1 monoclonal antibody (M05), clone 1B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HLX1.
Información adicional
Size 100 ug
Gene Name HLX
Gene Alias HB24|HLX1
Gene Description H2.0-like homeobox
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq FGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HLX1 (NP_068777, 176 a.a. ~ 279 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3142
Clone Number 1B9
Iso type IgG2a Kappa

Enviar uma mensagem


HLX1 monoclonal antibody (M05), clone 1B9

HLX1 monoclonal antibody (M05), clone 1B9