HLX purified MaxPab rabbit polyclonal antibody (D01P)
  • HLX purified MaxPab rabbit polyclonal antibody (D01P)

HLX purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003142-D01P
HLX purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HLX protein.
Información adicional
Size 100 ug
Gene Name HLX
Gene Alias HB24|HLX1
Gene Description H2.0-like homeobox
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFAAGLAPFYASNFSLWSAAYCSSAGPGGCSFPLDPAAVKKPSFCIADILHAGVGDLGAAPEGLAGASAAALTAHLGSVHPHASFQAAARSPLRPTPVVAPSEVPAGFPQRLSPLSAAYHHHHPQQQQQQQQPQQQQPPPPPRAGALQPPASGTRVVPNPHHSGSAPAPSSKDLKFGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HLX (NP_068777.1, 1 a.a. ~ 488 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3142

Enviar uma mensagem


HLX purified MaxPab rabbit polyclonal antibody (D01P)

HLX purified MaxPab rabbit polyclonal antibody (D01P)