HLA-E MaxPab rabbit polyclonal antibody (D01)
  • HLA-E MaxPab rabbit polyclonal antibody (D01)

HLA-E MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003133-D01
HLA-E MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HLA-E protein.
Información adicional
Size 100 uL
Gene Name HLA-E
Gene Alias DKFZp686P19218|EA1.2|EA2.1|HLA-6.2|MHC|QA1
Gene Description major histocompatibility complex, class I, E
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HLA-E (AAH02578.1, 1 a.a. ~ 358 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3133

Enviar uma mensagem


HLA-E MaxPab rabbit polyclonal antibody (D01)

HLA-E MaxPab rabbit polyclonal antibody (D01)