HLA-DRB4 purified MaxPab mouse polyclonal antibody (B01P)
  • HLA-DRB4 purified MaxPab mouse polyclonal antibody (B01P)

HLA-DRB4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003126-B01P
HLA-DRB4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HLA-DRB4 protein.
Información adicional
Size 50 ug
Gene Name HLA-DRB4
Gene Alias DRB4|HLA-DR4B
Gene Description major histocompatibility complex, class II, DR beta 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HLA-DRB4 (NP_068818.4, 1 a.a. ~ 266 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3126

Enviar uma mensagem


HLA-DRB4 purified MaxPab mouse polyclonal antibody (B01P)

HLA-DRB4 purified MaxPab mouse polyclonal antibody (B01P)