HLA-DRB3 purified MaxPab rabbit polyclonal antibody (D01P)
  • HLA-DRB3 purified MaxPab rabbit polyclonal antibody (D01P)

HLA-DRB3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003125-D01P
HLA-DRB3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HLA-DRB3 protein.
Información adicional
Size 100 ug
Gene Name HLA-DRB3
Gene Alias HLA-DR3B|MGC117330
Gene Description major histocompatibility complex, class II, DR beta 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HLA-DRB3 (NP_072049.2, 1 a.a. ~ 266 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3125

Enviar uma mensagem


HLA-DRB3 purified MaxPab rabbit polyclonal antibody (D01P)

HLA-DRB3 purified MaxPab rabbit polyclonal antibody (D01P)