HDGF polyclonal antibody (A01)
  • HDGF polyclonal antibody (A01)

HDGF polyclonal antibody (A01)

Ref: AB-H00003068-A01
HDGF polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HDGF.
Información adicional
Size 50 uL
Gene Name HDGF
Gene Alias DKFZp686J1764|FLJ96580|HMG1L2
Gene Description hepatoma-derived growth factor (high-mobility group protein 1-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TLEVERPLPMEVEKNSTPSEPGSGRGPPQEEEEEEDEEEEATKEDAEAPGIRDHESL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HDGF (NP_004485, 184 a.a. ~ 240 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3068

Enviar uma mensagem


HDGF polyclonal antibody (A01)

HDGF polyclonal antibody (A01)