HD monoclonal antibody (M05), clone 1H6
  • HD monoclonal antibody (M05), clone 1H6

HD monoclonal antibody (M05), clone 1H6

Ref: AB-H00003064-M05
HD monoclonal antibody (M05), clone 1H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HD.
Información adicional
Size 100 ug
Gene Name HTT
Gene Alias HD|IT15
Gene Description huntingtin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HD (NP_002102, 81 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3064
Clone Number 1H6
Iso type IgG2a Kappa

Enviar uma mensagem


HD monoclonal antibody (M05), clone 1H6

HD monoclonal antibody (M05), clone 1H6