HCRTR2 MaxPab rabbit polyclonal antibody (D01)
  • HCRTR2 MaxPab rabbit polyclonal antibody (D01)

HCRTR2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003062-D01
HCRTR2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HCRTR2 protein.
Información adicional
Size 100 uL
Gene Name HCRTR2
Gene Alias OX2R
Gene Description hypocretin (orexin) receptor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HCRTR2 (NP_001517.1, 1 a.a. ~ 444 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3062

Enviar uma mensagem


HCRTR2 MaxPab rabbit polyclonal antibody (D01)

HCRTR2 MaxPab rabbit polyclonal antibody (D01)