HCLS1 monoclonal antibody (M02), clone 1A8
  • HCLS1 monoclonal antibody (M02), clone 1A8

HCLS1 monoclonal antibody (M02), clone 1A8

Ref: AB-H00003059-M02
HCLS1 monoclonal antibody (M02), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HCLS1.
Información adicional
Size 100 ug
Gene Name HCLS1
Gene Alias CTTNL|HS1
Gene Description hematopoietic cell-specific Lyn substrate 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab,PLA-Ce
Immunogen Prot. Seq QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HCLS1 (AAH16758, 266 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3059
Clone Number 1A8
Iso type IgG1 Kappa

Enviar uma mensagem


HCLS1 monoclonal antibody (M02), clone 1A8

HCLS1 monoclonal antibody (M02), clone 1A8