HCK monoclonal antibody (M02), clone 2A6 View larger

Mouse monoclonal antibody raised against a partial recombinant HCK.

AB-H00003055-M02

New product

HCK monoclonal antibody (M02), clone 2A6

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name HCK
Gene Alias JTK9
Gene Description hemopoietic cell kinase
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq MGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HCK (AAH14435, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3055
Clone Number 2A6
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant HCK.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant HCK.

Mouse monoclonal antibody raised against a partial recombinant HCK.