HCK monoclonal antibody (M02), clone 2A6
  • HCK monoclonal antibody (M02), clone 2A6

HCK monoclonal antibody (M02), clone 2A6

Ref: AB-H00003055-M02
HCK monoclonal antibody (M02), clone 2A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HCK.
Información adicional
Size 100 ug
Gene Name HCK
Gene Alias JTK9
Gene Description hemopoietic cell kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq MGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HCK (AAH14435, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3055
Clone Number 2A6
Iso type IgG2a Kappa

Enviar uma mensagem


HCK monoclonal antibody (M02), clone 2A6

HCK monoclonal antibody (M02), clone 2A6