HCCS purified MaxPab rabbit polyclonal antibody (D01P)
  • HCCS purified MaxPab rabbit polyclonal antibody (D01P)

HCCS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003052-D01P
HCCS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HCCS protein.
Información adicional
Size 100 ug
Gene Name HCCS
Gene Alias CCHL|DKFZp779I1858|MCOPS7
Gene Description holocytochrome c synthase (cytochrome c heme-lyase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HCCS (AAH01691.1, 1 a.a. ~ 268 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3052

Enviar uma mensagem


HCCS purified MaxPab rabbit polyclonal antibody (D01P)

HCCS purified MaxPab rabbit polyclonal antibody (D01P)