HCCS polyclonal antibody (A01)
  • HCCS polyclonal antibody (A01)

HCCS polyclonal antibody (A01)

Ref: AB-H00003052-A01
HCCS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HCCS.
Información adicional
Size 50 uL
Gene Name HCCS
Gene Alias CCHL|DKFZp779I1858|MCOPS7
Gene Description holocytochrome c synthase (cytochrome c heme-lyase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HCCS (NP_005324, 169 a.a. ~ 268 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3052

Enviar uma mensagem


HCCS polyclonal antibody (A01)

HCCS polyclonal antibody (A01)