HBB monoclonal antibody (M01), clone 2H3
  • HBB monoclonal antibody (M01), clone 2H3

HBB monoclonal antibody (M01), clone 2H3

Ref: AB-H00003043-M01
HBB monoclonal antibody (M01), clone 2H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HBB.
Información adicional
Size 100 ug
Gene Name HBB
Gene Alias CD113t-C
Gene Description hemoglobin, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3043
Clone Number 2H3
Iso type IgG3 Kappa

Enviar uma mensagem


HBB monoclonal antibody (M01), clone 2H3

HBB monoclonal antibody (M01), clone 2H3