HBA1 monoclonal antibody (M02), clone 4F9
  • HBA1 monoclonal antibody (M02), clone 4F9

HBA1 monoclonal antibody (M02), clone 4F9

Ref: AB-H00003039-M02
HBA1 monoclonal antibody (M02), clone 4F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HBA1.
Información adicional
Size 100 ug
Gene Name HBA1
Gene Alias HBH|HBA-T3
Gene Description hemoglobin, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HBA1 (NP_000549, 33 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3039
Clone Number 4F9
Iso type IgG2a Kappa

Enviar uma mensagem


HBA1 monoclonal antibody (M02), clone 4F9

HBA1 monoclonal antibody (M02), clone 4F9